General Information

  • ID:  hor001618
  • Uniprot ID:  O15130(93-110)
  • Protein name:  Neuropeptide AF
  • Gene name:  NPFF
  • Organism:  Homo sapiens (Human)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with NPFF include Migraine With Aura and Opiate Dependence.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0060079 excitatory postsynaptic potential
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030425 dendrite; GO:0043204 perikaryon; GO:0043679 axon terminus; GO:0098794 postsynapse

Sequence Information

  • Sequence:  AGEGLNSQFWSLAAPQRF
  • Length:  18(93-110)
  • Propeptide:  MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
  • Signal peptide:  MDSRQAAALLVLLLLIDGGC
  • Modification:  T18 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPFFR2, NPFFR1
  • Target Unid:  Q9Y5X5, Q9GZQ6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O15130-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001618_AF2.pdbhor001618_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 228259 Formula: C90H131N25O26
Absent amino acids: CDHIKMTVY Common amino acids: A
pI: 6.41 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 8
Hydrophobicity: -26.67 Boman Index: -2081
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60
Instability Index: 3266.67 Extinction Coefficient cystines: 5500
Absorbance 280nm: 323.53

Literature

  • PubMed ID:  NA
  • Title:  NA